PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016468802.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 821aa    MW: 91030 Da    PI: 6.7476
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016468802.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.14e-0885127347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT +E+e +  a +q G++ +++I ++++  +   q++++++ +
   XP_016468802.1  85 AWTRQEEESFFSALRQVGKN-FEKITSRVQ-SKNKDQVRHYYYRL 127
                      6*****************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.08E-1080132IPR009057Homeodomain-like
PROSITE profilePS5129313.41381132IPR017884SANT domain
SMARTSM007173.2E-682130IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-584130IPR009057Homeodomain-like
PfamPF002493.4E-685127IPR001005SANT/Myb domain
CDDcd001678.98E-685128No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 821 aa     Download sequence    Send to blast
MQMEPQVSLE CDRCLHPETL MCKDGVSDDT QHPAAAQPVI TSEDHPAAQL SVLIYDHAVT  60
QQVSLSQDQV MLQKPAKRQT RQWAAWTRQE EESFFSALRQ VGKNFEKITS RVQSKNKDQV  120
RHYYYRLVRR MNKLLGPELS LDAKNSKDTN AAMLRWWSLL EKSSCKASKL HLKPRRFKIF  180
IETLESQLLK DRKKNVRRRP SQGESSSTAA ASLSSHSRVS TNDSRTVKVV LLDNQDVQKF  240
GSGKGSSLKR HVTMGVNRSN TKVDSSPVKN ARHRRKIGSV STAAYKRWEK AAIAGVSLVA  300
DAAEHLERAT IDKDVGLVQN SQGINGFEHV GKDVPSLPTL SQNLLNETNL QSCMKLKLQL  360
FPVDEGTRRA LEMDNHNPYL ELTLSNRKKM SSILEHLNRK WGSSSIATGK LVLFPYHVQM  420
ENLVQSLRWT KDTTLSAADV YNLIGSPPVF RLRYGWFPNS ELGTFQAPLS STTPFTQNTN  480
TNITEEKNEE VLASSHGKLV RFSKEPLVSN PRMTVTSSST ELSGESNLQA TMGVNTYNSD  540
HNETLLMHRR DNGAITTEKQ VEMHDMQGSK NSALSAGDWE DSLTNISVGD LLSDAPDDEE  600
TDCIESTLPG SSHFLQQMPF SCDSFDAAIA AHIYKHQSKA ESQMALPPQA SSIWNAEDTC  660
DAFAFQKDVA FRRTANNSSS NVGAENRQHI SQSSSLLLDA GVKDLPGKME PLTDELAHED  720
PVDECHAQAL GGSTKDLSGL SDIYWPDSLG PLELDAPSCR YHSEDLILSD NSLGGLNRLI  780
ASSLDAFQNC SFFGLDKKEP GSTVEAVETT SLADYKIGAK V
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF6476041e-126EF647604.1 Solanum lycopersicum chromosome 9 clone C09HBa0116C14, complete sequence.
GenBankHG9755211e-126HG975521.1 Solanum lycopersicum chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009802692.10.0PREDICTED: TSL-kinase interacting protein 1 isoform X4
RefseqXP_009802693.10.0PREDICTED: TSL-kinase interacting protein 1 isoform X4
RefseqXP_009802694.10.0PREDICTED: TSL-kinase interacting protein 1 isoform X4
RefseqXP_009802695.10.0PREDICTED: TSL-kinase interacting protein 1 isoform X4
RefseqXP_009802696.10.0PREDICTED: TSL-kinase interacting protein 1 isoform X4
RefseqXP_009802697.10.0PREDICTED: TSL-kinase interacting protein 1 isoform X4
RefseqXP_016468795.10.0PREDICTED: TSL-kinase interacting protein 1-like isoform X1
RefseqXP_016468796.10.0PREDICTED: TSL-kinase interacting protein 1-like isoform X1
RefseqXP_016468797.10.0PREDICTED: TSL-kinase interacting protein 1-like isoform X1
RefseqXP_016468798.10.0PREDICTED: TSL-kinase interacting protein 1-like isoform X1
RefseqXP_016468799.10.0PREDICTED: TSL-kinase interacting protein 1-like isoform X1
RefseqXP_016468800.10.0PREDICTED: TSL-kinase interacting protein 1-like isoform X1
RefseqXP_016468801.10.0PREDICTED: TSL-kinase interacting protein 1-like isoform X1
RefseqXP_016468802.10.0PREDICTED: TSL-kinase interacting protein 1-like isoform X1
SwissprotQ8LJT80.0TKI1_ARATH; TSL-kinase interacting protein 1
TrEMBLK4CQJ90.0K4CQJ9_SOLLC; Uncharacterized protein
STRINGSolyc09g008100.2.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36960.30.0TSL-kinase interacting protein 1